PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619948.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 271aa    MW: 31382.8 Da    PI: 9.0166
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619948.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.85.9e-193178148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++v+  G g W+++a++ g++R++k+c++rw +yl
   XP_013619948.1 31 KGPWTPEEDKLLTEYVTSKGEGKWSSVAKCAGLNRSGKSCRLRWVNYL 78
                     79********************************************97 PP

2Myb_DNA-binding506.9e-1684128147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ ++++++ ++G++ W+tIar+++ gRt++++k++w+++
   XP_013619948.1  84 RGQITPQEEGIILELHSLWGNK-WSTIARYLP-GRTDNEIKNYWRTH 128
                      7888******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1542678IPR017930Myb domain
SuperFamilySSF466893.01E-3128125IPR009057Homeodomain-like
SMARTSM007171.8E-153080IPR001005SANT/Myb domain
PfamPF002495.1E-173178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-243285IPR009057Homeodomain-like
CDDcd001672.36E-113378No hitNo description
PROSITE profilePS5129423.84679133IPR017930Myb domain
SMARTSM007171.8E-1383131IPR001005SANT/Myb domain
PfamPF002499.9E-1484128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2386132IPR009057Homeodomain-like
CDDcd001671.30E-988128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MLDWGVDQVH QPNHDHDPYQ KQQKQLQGCR KGPWTPEEDK LLTEYVTSKG EGKWSSVAKC  60
AGLNRSGKSC RLRWVNYLRP GLKRGQITPQ EEGIILELHS LWGNKWSTIA RYLPGRTDNE  120
IKNYWRTHYK KKDKSFSKQD KYKRSRKQLG MQPQPQNQRS QMVSQNHMNH DNEQNIASSF  180
SYPTSVIHDQ FHMPQSVTAT SSDHSMIDEG NLWGSLWSLN DEDRPHRFGG GWEQRTAADI  240
SEKFNGDRIE APPCGSGEYN YNGFYTGGYI F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25311327107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719801e-131AF371980.2 Arabidopsis thaliana putative transcription factor MYB121 (MYB121) mRNA, complete cds.
GenBankAY5195931e-131AY519593.1 Arabidopsis thaliana MYB transcription factor (At3g30210) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619948.10.0PREDICTED: myb-related protein 340-like
RefseqXP_013705986.10.0PREDICTED: myb-related protein 340-like
TrEMBLA0A078I4T41e-177A0A078I4T4_BRANA; BnaAnng07760D protein
TrEMBLM4DW501e-177M4DW50_BRARP; Uncharacterized protein
STRINGBra020744.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.11e-136myb domain protein 121